|
|
|
|
|
|
|
| Information on 1a3w_A_82 |
|
Loop code: 1a3w_A_82 PDB: 1a3w Chain: A Type: AR beta-beta link |
Loop Start: 82 Loop Length: 23 Sec Struct Nt length: 3 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | ALDTKGPEIRTGTTTNDVDYPIPPNHEMIFT |
| Sec Struct: | EEE---S--BB---SSSS-----SS-EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PGA2-PHOSPHOGLYCOLIC ACID | D - 84 | 0 | 1 |
| PGA2-PHOSPHOGLYCOLIC ACID | T - 85 | 0 | 1 |
| PGA2-PHOSPHOGLYCOLIC ACID | E - 89 | 0 | 1 |
| PGA2-PHOSPHOGLYCOLIC ACID | R - 91 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|