|
|
|
|
|
|
|
| Information on 1jof_A_27 |
|
Loop code: 1jof_A_27 PDB: 1jof Chain: A Type: AR beta-beta link |
Loop Start: 27 Loop Length: 16 Sec Struct Nt length: 9 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | TCKLIKRTEIPQDEPISWTFDHERKNIYGA |
| Sec Struct: | EEEEEEEEE--TT------B-TTSSEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | D - 39 | 0 | 1 |
| MSESELENOMETHIONINE | E - 40 | 0 | 1 |
| MSESELENOMETHIONINE | P - 41 | 0 | 1 |
| MSESELENOMETHIONINE | I - 42 | 0 | 1 |
| MSESELENOMETHIONINE | S - 43 | 0 | 1 |
| MSESELENOMETHIONINE | W - 44 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|