|
|
|
|
|
|
|
| Information on 1i78_A_97 |
|
Loop code: 1i78_A_97 PDB: 1i78 Chain: A Type: HA beta-beta hairpin |
Loop Start: 97 Loop Length: 3 Sec Struct Nt length: 26 Sec Struct Ct length: 19 Structure geometry
|
| Sequence: | DEARHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTAR |
| Sec Struct: | EEEEEEEEEEEEEEEEEEEEEEEEEE-SSEEEEEEEEEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| BOGB-OCTYLGLUCOSIDE | Q - 105 | 1 | 0 |
| BOGB-OCTYLGLUCOSIDE | N - 107 | 1 | 0 |
| BOGB-OCTYLGLUCOSIDE | Y - 108 | 1 | 0 |
| BOGB-OCTYLGLUCOSIDE | N - 110 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | K - 117 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | G - 118 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | W - 119 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | L - 120 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | L - 121 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|