|
|
|
|
|
|
|
| Information on 1iab_*_134 |
|
Loop code: 1iab_*_134 PDB: 1iab Chain: * Type: AR beta-beta link |
Loop Start: 134 Loop Length: 28 Sec Struct Nt length: 2 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | SRYVGEDYQYYSIMHYGKYSFSIQWGVLETIVP |
| Sec Struct: | EE--S----TT-TT---TTTTBSSTTTS-SEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| COCOBALT (II) ION | M - 147 | 0 | 1 |
| COCOBALT (II) ION | Y - 149 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|