|
|
|
|
|
|
|
| Information on 1kgd_A_847 |
|
Loop code: 1kgd_A_847 PDB: 1kgd Chain: A Type: EH beta-alpha |
Loop Start: 847 Loop Length: 11 Sec Struct Nt length: 7 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | PFVVFIAAPTITPGLNEDESLQRLQKESDILQRTY |
| Sec Struct: | EEEEEEE--S--TTS--SHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FMTFORMIC ACID | P - 855 | 0 | 1 |
| FMTFORMIC ACID | L - 861 | 0 | 1 |
| FMTFORMIC ACID | D - 864 | 0 | 1 |
| FMTFORMIC ACID | S - 866 | 1 | 0 |
| FMTFORMIC ACID | L - 867 | 1 | 0 |
| FMTFORMIC ACID | L - 870 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|