|
|
|
|
|
|
|
| Information on 1g8m_A_385 |
|
Loop code: 1g8m_A_385 PDB: 1g8m Chain: A Type: EH beta-alpha |
Loop Start: 385 Loop Length: 25 Sec Struct Nt length: 2 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | LQLQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVK |
| Sec Struct: | EE--B------SGGGG--B-SSS----HHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | L - 385 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 386 | 0 | 1 |
| GGUANOSINE-5'-MONOPHOSPHATE | L - 387 | 0 | 1 |
| MSESELENOMETHIONINE | L - 387 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|