|
|
|
|
|
|
|
| Information on 1msk_*_906 |
|
Loop code: 1msk_*_906 PDB: 1msk Chain: * Type: HE alpha-beta |
Loop Start: 906 Loop Length: 18 Sec Struct Nt length: 6 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | LEAARDNDFAFDWQAYTPPVAHRLGVQEVE |
| Sec Struct: | HHHHHHT-----STT------SS-EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACTACETATE ION | R - 928 | 0 | 1 |
| ACTACETATE ION | Q - 932 | 1 | 0 |
| ACTACETATE ION | E - 933 | 1 | 0 |
| ACTACETATE ION | V - 934 | 1 | 0 |
| ACTACETATE ION | E - 935 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|