|
|
|
|
|
|
|
| Information on 1mx1_A_1291 |
|
Loop code: 1mx1_A_1291 PDB: 1mx1 Chain: A Type: HE alpha-beta |
Loop Start: 1291 Loop Length: 19 Sec Struct Nt length: 11 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | EEELLETTLKMKFLSLDLQGDPRESQPLLGTV |
| Sec Struct: | HHHHHHHHHHHT-SS---SS-GGG------EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| THATACRINE | L - 1304 | 0 | 1 |
| THATACRINE | L - 1318 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|