|
|
|
|
|
|
|
| Information on 1gz7_A_21 |
|
Loop code: 1gz7_A_21 PDB: 1gz7 Chain: A Type: EH beta-alpha |
Loop Start: 21 Loop Length: 47 Sec Struct Nt length: 7 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | EKFLGIPFAEPPVGTLRFKPPVPYSASLNGQQFTSYGPSCMQMNPMGSFEDTLPKNALDLVLQS |
| Sec Struct: | EEEEEEE-B----GGGTTS---B--S--TT-B-BS---B---------GGGTS-HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | P - 40 | 0 | 1 |
| GOLGLYCEROL | P - 41 | 0 | 1 |
| GOLGLYCEROL | V - 42 | 0 | 1 |
| GOLGLYCEROL | P - 43 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| BC4 - GOL BINDING SITE FOR CHAIN A | P - 41 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|