|
|
|
|
|
|
|
| Information on 1kl7_A_316 |
|
Loop code: 1kl7_A_316 PDB: 1kl7 Chain: A Type: EH beta-alpha |
Loop Start: 316 Loop Length: 19 Sec Struct Nt length: 3 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | LYERSDKVAATLSPADILISSNFERLLWYLAREY |
| Sec Struct: | EEE--SS----S-----SS-TTHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | T - 326 | 0 | 1 |
| MSESELENOMETHIONINE | S - 328 | 0 | 1 |
| MSESELENOMETHIONINE | P - 329 | 0 | 1 |
| MSESELENOMETHIONINE | A - 330 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | A - 330 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | S - 336 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|