|
|
|
|
|
|
|
| Information on 1fa2_A_86 |
|
Loop code: 1fa2_A_86 PDB: 1fa2 Chain: A Type: EH beta-alpha |
Loop Start: 86 Loop Length: 17 Sec Struct Nt length: 7 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | KIQAIMSFHQCGGNVGDAVFIPIPQWILQI |
| Sec Struct: | EEEEEEE-S-B---TT----B-S-HHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE | I - 90 | 1 | 0 |
| DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE | S - 92 | 0 | 1 |
| DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE | H - 94 | 0 | 1 |
| DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE | Q - 95 | 0 | 1 |
| DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE | C - 96 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|