|
|
|
|
|
|
|
| Information on 1dbg_A_452 |
|
Loop code: 1dbg_A_452 PDB: 1dbg Chain: A Type: HH alpha-alpha |
Loop Start: 452 Loop Length: 23 Sec Struct Nt length: 7 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | LNALISKGITGKPLSWDEVRPYWLKEMPGTYALT |
| Sec Struct: | HHHHHHH-S-S----GGGTS-TT--S--SSHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| RAMRHAMNOSE | T - 461 | 0 | 1 |
| RAMRHAMNOSE | G - 462 | 0 | 1 |
| RAMRHAMNOSE | K - 463 | 0 | 1 |
| RAMRHAMNOSE | P - 464 | 0 | 1 |
| MANALPHA-D-MANNOSE | L - 465 | 0 | 1 |
| RAMRHAMNOSE | L - 465 | 0 | 1 |
| MANALPHA-D-MANNOSE | E - 469 | 0 | 1 |
| RAMRHAMNOSE | E - 469 | 0 | 1 |
| MANALPHA-D-MANNOSE | V - 470 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|