|
|
|
|
|
|
|
| Information on 1f5a_A_265 |
|
Loop code: 1f5a_A_265 PDB: 1f5a Chain: A Type: HH alpha-alpha |
Loop Start: 265 Loop Length: 58 Sec Struct Nt length: 13 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | ASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVWDPRVNPSDRYHLPIITPAYPQQNSTYNVSVSTRVVEEFKQGLAITDEIL |
| Sec Struct: | HHHHHHHHHHHHHT--TTS-B-SS------S------TTT-GGGGG---BB-SSSS--BTTTT--TTT---HHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | F - 276 | 0 | 1 |
| MSESELENOMETHIONINE | W - 281 | 0 | 1 |
| MSESELENOMETHIONINE | P - 282 | 0 | 1 |
| MSESELENOMETHIONINE | V - 285 | 0 | 1 |
| MSESELENOMETHIONINE | L - 287 | 0 | 1 |
| MSESELENOMETHIONINE | H - 311 | 0 | 1 |
| MSESELENOMETHIONINE | L - 312 | 0 | 1 |
| MSESELENOMETHIONINE | I - 315 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|