|
|
|
|
|
|
|
| Information on 1fc4_A_279 |
|
Loop code: 1fc4_A_279 PDB: 1fc4 Chain: A Type: HH alpha-alpha |
Loop Start: 279 Loop Length: 5 Sec Struct Nt length: 11 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | PAIVAASIKVLEVEAGSELRDRLWANARQFRE |
| Sec Struct: | HHHHHHHHHHH--TT-HHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | P - 279 | 1 | 0 |
| MSESELENOMETHIONINE | A - 280 | 1 | 0 |
| MSESELENOMETHIONINE | A - 283 | 1 | 0 |
| MSESELENOMETHIONINE | I - 286 | 1 | 0 |
| MSESELENOMETHIONINE | K - 287 | 1 | 0 |
| MSESELENOMETHIONINE | V - 288 | 0 | 1 |
| MSESELENOMETHIONINE | L - 289 | 0 | 1 |
| MSESELENOMETHIONINE | E - 290 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|