|
|
|
|
|
|
|
| Information on 1jvs_A_277 |
|
Loop code: 1jvs_A_277 PDB: 1jvs Chain: A Type: HH alpha-alpha |
Loop Start: 277 Loop Length: 32 Sec Struct Nt length: 5 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | TPIAHTAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKL |
| Sec Struct: | HHHHH--TTS----S-----GGG------B---TTT-HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | T - 277 | 1 | 0 |
| MSESELENOMETHIONINE | P - 278 | 1 | 0 |
| MSESELENOMETHIONINE | I - 279 | 1 | 0 |
| MSESELENOMETHIONINE | A - 280 | 0 | 1 |
| MSESELENOMETHIONINE | H - 281 | 0 | 1 |
| MSESELENOMETHIONINE | T - 282 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|