|
|
|
|
|
|
|
| Information on 1dmu_A_60 |
|
Loop code: 1dmu_A_60 PDB: 1dmu Chain: A Type: HH alpha-alpha |
Loop Start: 60 Loop Length: 19 Sec Struct Nt length: 4 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | HPFWMNYPPLDRGKMPKGDQIPWIEVGEKA |
| Sec Struct: | HHHHTTS-----SSS--SS----HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | D - 70 | 0 | 1 |
| CACALCIUM ION | G - 77 | 0 | 1 |
| CACALCIUM ION | D - 78 | 0 | 1 |
| CACALCIUM ION | Q - 79 | 0 | 1 |
| CACALCIUM ION | I - 80 | 0 | 1 |
| CACALCIUM ION | E - 87 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|