|
|
|
|
|
|
|
| Information on 1ls6_A_132 |
|
Loop code: 1ls6_A_132 PDB: 1ls6 Chain: A Type: HH alpha-alpha |
Loop Start: 132 Loop Length: 9 Sec Struct Nt length: 14 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | AKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMV |
| Sec Struct: | HHHHHHHHHHHHHHBTTS-----HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | D - 134 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | V - 137 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | S - 138 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | Y - 139 | 1 | 0 |
| A3PADENOSINE-3'-5'-DIPHOSPHATE | F - 142 | 1 | 0 |
| NPOP-NITROPHENOL | F - 142 | 1 | 0 |
| NPOP-NITROPHENOL | A - 146 | 0 | 1 |
| NPOP-NITROPHENOL | V - 148 | 0 | 1 |
| NPOP-NITROPHENOL | H - 149 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|