|
|
|
|
|
|
|
| Information on 1hbn_C_33 |
|
Loop code: 1hbn_C_33 PDB: 1hbn Chain: C Type: HH alpha-alpha |
Loop Start: 33 Loop Length: 24 Sec Struct Nt length: 8 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | DEDVVKILGHRAPGEEYPSVHPPLEEMDEPEDAIREM |
| Sec Struct: | HHHHHHHH-SS-TT----BSS--GGGS-----HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | D - 33 | 1 | 0 |
| MGMAGNESIUM ION | E - 34 | 1 | 0 |
| MGMAGNESIUM ION | D - 35 | 1 | 0 |
| MGMAGNESIUM ION | K - 38 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|