|
|
|
|
|
|
|
| Information on 1kg2_A_119 |
|
Loop code: 1kg2_A_119 PDB: 1kg2 Chain: A Type: HH alpha-alpha |
Loop Start: 119 Loop Length: 8 Sec Struct Nt length: 12 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | RSTAGAILSLSLGKHFPILDGNVKRVLARCY |
| Sec Struct: | HHHHHHHHHHHH--S-----HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | R - 119 | 1 | 0 |
| GOLGLYCEROL | G - 123 | 1 | 0 |
| GOLGLYCEROL | F - 134 | 0 | 1 |
| GOLGLYCEROL | P - 135 | 0 | 1 |
| FS4IRON/SULFUR CLUSTER | R - 143 | 1 | 0 |
| FS4IRON/SULFUR CLUSTER | V - 144 | 1 | 0 |
| FS4IRON/SULFUR CLUSTER | R - 147 | 1 | 0 |
| FS4IRON/SULFUR CLUSTER | C - 148 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|