|
|
|
|
|
|
|
| Information on 1fw1_A_93 |
|
Loop code: 1fw1_A_93 PDB: 1fw1 Chain: A Type: HH alpha-alpha |
Loop Start: 93 Loop Length: 6 Sec Struct Nt length: 17 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | PKKRASVRMISDLIAGGIQPLQNLSVLKQV |
| Sec Struct: | HHHHHHHHHHHHHHHHHTGGGG-HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GSHGLUTHATHIONE | A - 107 | 1 | 0 |
| GSHGLUTHATHIONE | Q - 111 | 0 | 1 |
| GSHGLUTHATHIONE | P - 112 | 0 | 1 |
| GSHGLUTHATHIONE | N - 115 | 0 | 1 |
| GSHGLUTHATHIONE | L - 116 | 0 | 1 |
| GSHGLUTHATHIONE | S - 117 | 1 | 0 |
| GSHGLUTHATHIONE | V - 118 | 1 | 0 |
| GSHGLUTHATHIONE | K - 120 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|