|
|
|
|
|
|
|
| Information on 1oe8_A_89 |
|
Loop code: 1oe8_A_89 PDB: 1oe8 Chain: A Type: HH alpha-alpha |
Loop Start: 89 Loop Length: 6 Sec Struct Nt length: 22 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | EEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEIL |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHTTTT--HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GSHGLUTHATHIONE | G - 100 | 1 | 0 |
| GSHGLUTHATHIONE | Q - 101 | 1 | 0 |
| GSHGLUTHATHIONE | D - 104 | 1 | 0 |
| GSHGLUTHATHIONE | M - 114 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC2 - GSH BINDING SITE FOR CHAIN B | D - 104 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|