|
|
|
|
|
|
|
| Information on 1bqq_M_233 |
|
Loop code: 1bqq_M_233 PDB: 1bqq Chain: M Type: HH alpha-alpha |
Loop Start: 233 Loop Length: 29 Sec Struct Nt length: 11 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | IFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDR |
| Sec Struct: | HHHHHHHHHHHTTT----S-TT-SSSSS-----STT----HHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | H - 239 | 1 | 0 |
| ZNZINC ION | E - 240 | 1 | 0 |
| ZNZINC ION | H - 243 | 0 | 1 |
| ZNZINC ION | H - 249 | 0 | 1 |
| ZNZINC ION | M - 257 | 0 | 1 |
| ZNZINC ION | A - 258 | 0 | 1 |
| ZNZINC ION | P - 259 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|