|
|
|
|
|
|
|
| Information on 1gp7_A_40 |
|
Loop code: 1gp7_A_40 PDB: 1gp7 Chain: A Type: HH alpha-alpha |
Loop Start: 40 Loop Length: 9 Sec Struct Nt length: 18 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | KLDRCCQVHDNCYTQAQKLPACSSIMDSPYV |
| Sec Struct: | HHHHHHHHHHHHHHHHHH-GGGTT-TTHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | C - 45 | 1 | 0 |
| CACALCIUM ION | D - 49 | 1 | 0 |
| CACALCIUM ION | D - 66 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| CAA - CA BINDING SITE FOR CHAIN A | D - 49 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|