|
|
|
|
|
|
|
| Information on 1kv9_A_404 |
|
Loop code: 1kv9_A_404 PDB: 1kv9 Chain: A Type: AR beta-beta link |
Loop Start: 404 Loop Length: 30 Sec Struct Nt length: 3 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | GVYRNEGKDFVTRKAFNTAAGFADATDVPAAVVSGALLAWD |
| Sec Struct: | EEE---GGG----SS---SS-GGG-----GGG-EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACNACETONE | F - 419 | 0 | 1 |
| ACNACETONE | F - 425 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|