|
|
|
|
|
|
|
| Information on 1iby_A_4 |
|
Loop code: 1iby_A_4 PDB: 1iby Chain: A Type: HA beta-beta hairpin |
Loop Start: 4 Loop Length: 2 Sec Struct Nt length: 17 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | FNVVINAYDTTIPELNVEGVTVKNIRAFNVLNE |
| Sec Struct: | EEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CUCOPPER (II) ION | I - 8 | 1 | 0 |
| HEZHEXANE-1,6-DIOL | A - 10 | 1 | 0 |
| HEZHEXANE-1,6-DIOL | I - 15 | 1 | 0 |
| HEZHEXANE-1,6-DIOL | L - 18 | 1 | 0 |
| HEZHEXANE-1,6-DIOL | V - 20 | 0 | 1 |
| HEZHEXANE-1,6-DIOL | I - 28 | 1 | 0 |
| HEZHEXANE-1,6-DIOL | F - 31 | 1 | 0 |
| CUCOPPER (II) ION | V - 33 | 1 | 0 |
| HEZHEXANE-1,6-DIOL | V - 33 | 1 | 0 |
| Associated ArchDB40 Subclass to 1iby_A_4 |
| Associated ArchDB95 Subclass to 1iby_A_4 |
| For any comment or web-related incidence, send an email to the webmaster. |
|