|
|
|
|
|
|
|
| Information on 1sac_A_130 |
|
Loop code: 1sac_A_130 PDB: 1sac Chain: A Type: AR beta-beta link |
Loop Start: 130 Loop Length: 18 Sec Struct Nt length: 4 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | KIVLGQEQDSYGGKFDRSQSFVGEIGDLYMW |
| Sec Struct: | EEEESS--SSSS----GGG---EEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | E - 136 | 0 | 1 |
| CACALCIUM ION | Q - 137 | 0 | 1 |
| CACALCIUM ION | D - 138 | 0 | 1 |
| CACALCIUM ION | S - 139 | 0 | 1 |
| CACALCIUM ION | K - 143 | 0 | 1 |
| CACALCIUM ION | F - 144 | 0 | 1 |
| CACALCIUM ION | D - 145 | 0 | 1 |
| CACALCIUM ION | Q - 148 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|