|
|
|
|
|
|
|
| Information on 1q2w_A_121 |
|
Loop code: 1q2w_A_121 PDB: 1q2w Chain: A Type: AR beta-beta link |
Loop Start: 121 Loop Length: 18 Sec Struct Nt length: 9 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNID |
| Sec Struct: | EEEEEEEEE--TTS-B-----TT-TT-EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MPD2-METHYL-2,4-PENTANEDIOL | R - 131 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | P - 132 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|