|
|
|
|
|
|
|
| Information on 1vhe_A_233 |
|
Loop code: 1vhe_A_233 PDB: 1vhe Chain: A Type: AR beta-beta link |
Loop Start: 233 Loop Length: 19 Sec Struct Nt length: 8 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | AFGVDVGIAGDTPGISEKEAQSKGKGPQIIVYD |
| Sec Struct: | EEEEEEEE---STT--TTT--------EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | A - 233 | 1 | 0 |
| MSESELENOMETHIONINE | F - 234 | 1 | 0 |
| MSESELENOMETHIONINE | G - 235 | 1 | 0 |
| ZNZINC ION | D - 237 | 1 | 0 |
| ZNZINC ION | V - 238 | 1 | 0 |
| MSESELENOMETHIONINE | A - 241 | 0 | 1 |
| MSESELENOMETHIONINE | D - 243 | 0 | 1 |
| MSESELENOMETHIONINE | S - 254 | 0 | 1 |
| MSESELENOMETHIONINE | K - 255 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|