|
|
|
|
|
|
|
| Information on 1luq_A_1103 |
|
Loop code: 1luq_A_1103 PDB: 1luq Chain: A Type: HA beta-beta hairpin |
Loop Start: 1103 Loop Length: 10 Sec Struct Nt length: 10 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | RINTQWLLTSGTTEANAWKSTLVGHDTFTKV |
| Sec Struct: | EEEEEEEEEE---GGGGGG-EEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| BTNBIOTIN | W - 1108 | 1 | 0 |
| BTNBIOTIN | L - 1110 | 1 | 0 |
| BTNBIOTIN | S - 1112 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | A - 1117 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | N - 1118 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | W - 1120 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | K - 1121 | 0 | 1 |
| BTNBIOTIN | D - 1128 | 1 | 0 |
| BTNBIOTIN | F - 1130 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|