|
|
|
|
|
|
|
| Information on 1juh_A_249 |
|
Loop code: 1juh_A_249 PDB: 1juh Chain: A Type: AR beta-beta link |
Loop Start: 249 Loop Length: 17 Sec Struct Nt length: 8 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | YTLSTISMSTTPSTVTVPTWSFPGACAFQVQE |
| Sec Struct: | EEEEEEEE----TTS----B--SS-EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| EDO1,2-ETHANEDIOL | P - 260 | 0 | 1 |
| EDO1,2-ETHANEDIOL | V - 263 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | P - 271 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | G - 272 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | A - 273 | 0 | 1 |
| EDO1,2-ETHANEDIOL | V - 278 | 1 | 0 |
| EDO1,2-ETHANEDIOL | Q - 279 | 1 | 0 |
| EDO1,2-ETHANEDIOL | E - 280 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|