|
|
|
|
|
|
|
| Information on 1hi9_A_97 |
|
Loop code: 1hi9_A_97 PDB: 1hi9 Chain: A Type: AR beta-beta link |
Loop Start: 97 Loop Length: 17 Sec Struct Nt length: 7 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | GALFLGYHARASTPGVMSHSMIFGVRHFYI |
| Sec Struct: | EEEEEEE---TTSSSTT--SSSTTEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | G - 102 | 0 | 1 |
| ZNZINC ION | H - 104 | 0 | 1 |
| ZNZINC ION | H - 115 | 0 | 1 |
| ZNZINC ION | M - 117 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC1 - ZN BINDING SITE FOR RESIDUE A300 | H - 104 | 0 | 1 |
| AC1 - ZN BINDING SITE FOR RESIDUE A300 | H - 115 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|