|
|
|
|
|
|
|
| Information on 1j1n_A_290 |
|
Loop code: 1j1n_A_290 PDB: 1j1n Chain: A Type: AR beta-beta link |
Loop Start: 290 Loop Length: 22 Sec Struct Nt length: 4 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | LIPIAPPTNSKGQRWEEDSRQKVRPDGWAI |
| Sec Struct: | EEEE---B-TTS---B-----SS-S-EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MAW4-DEOXY-D-MANNURONIC ACID | R - 309 | 0 | 1 |
| LGUL-GLUCURONIC ACID | R - 313 | 0 | 1 |
| MAVD-MANNURONIC ACID | R - 313 | 0 | 1 |
| LGUL-GLUCURONIC ACID | D - 315 | 0 | 1 |
| MAVD-MANNURONIC ACID | D - 315 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|