|
|
|
|
|
|
|
| Information on 1qop_B_281 |
|
Loop code: 1qop_B_281 PDB: 1qop Chain: B Type: EH beta-alpha |
Loop Start: 281 Loop Length: 24 Sec Struct Nt length: 6 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | GMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLNS |
| Sec Struct: | EEEEEE-B-TTS-B-----SSGGG--SS--HHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PLPPYRIDOXAL-5'-PHOSPHATE | G - 303 | 0 | 1 |
| PLPPYRIDOXAL-5'-PHOSPHATE | L - 304 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| NA - NA BINDING SITE FOR CHAIN B | F - 306 | 0 | 1 |
| NA - NA BINDING SITE FOR CHAIN B | S - 308 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|