|
|
|
|
|
|
|
| Information on 1q40_B_336 |
|
Loop code: 1q40_B_336 PDB: 1q40 Chain: B Type: AR beta-beta link |
Loop Start: 336 Loop Length: 40 Sec Struct Nt length: 2 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | QFSQVDSSHPHLIESGSTDFGYYLNNSRNLTRVSSIKARAKLSI |
| Sec Struct: | EE--B-TT--------S---TTTTTT---TTT--STTT----EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | F - 337 | 0 | 1 |
| MSESELENOMETHIONINE | S - 338 | 0 | 1 |
| GOLGLYCEROL | S - 343 | 0 | 1 |
| GOLGLYCEROL | S - 369 | 0 | 1 |
| MSESELENOMETHIONINE | S - 369 | 0 | 1 |
| GOLGLYCEROL | R - 374 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|