|
|
|
|
|
|
|
| Information on 1q40_A_98 |
|
Loop code: 1q40_A_98 PDB: 1q40 Chain: A Type: HA beta-beta hairpin |
Loop Start: 98 Loop Length: 27 Sec Struct Nt length: 12 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | TFVVHFSAKVRFDQSGRNRLGESADLFQENNQRPIWGSWFGVDVNLVVD |
| Sec Struct: | EEEEEEEEEEEEB-SSB-TTS-B--SSS-------B---EEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | V - 100 | 1 | 0 |
| GOLGLYCEROL | D - 110 | 0 | 1 |
| GOLGLYCEROL | S - 112 | 0 | 1 |
| GOLGLYCEROL | R - 114 | 0 | 1 |
| GOLGLYCEROL | N - 115 | 0 | 1 |
| GOLGLYCEROL | R - 116 | 0 | 1 |
| GOLGLYCEROL | L - 117 | 0 | 1 |
| GOLGLYCEROL | G - 118 | 0 | 1 |
| GOLGLYCEROL | E - 119 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|