|
|
|
|
|
|
|
| Information on 1ols_A_279 |
|
Loop code: 1ols_A_279 PDB: 1ols Chain: A Type: EH beta-alpha |
Loop Start: 279 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | FLIEAMTYRIGHHSDDSSYRYWDKQDHPISRLRHYLLSQ |
| Sec Struct: | EEEEEE----S----------TTTSS-HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MNMANGANESE (II) ION | R - 287 | 0 | 1 |
| TDPTHIAMIN DIPHOSPHATE | R - 287 | 0 | 1 |
| TDPTHIAMIN DIPHOSPHATE | H - 291 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| TDP - TDP BINDING SITE FOR CHAIN A | H - 291 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|