|
|
|
|
|
|
|
| Information on 1vjf_A_81 |
|
Loop code: 1vjf_A_81 PDB: 1vjf Chain: A Type: AR beta-beta link |
Loop Start: 81 Loop Length: 27 Sec Struct Nt length: 3 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | LSFGPQELETLGVTPGSVTAFGLINDTEKRVRFVL |
| Sec Struct: | EEE-----TTT---TT---GGGGGG-TT--EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | G - 84 | 0 | 1 |
| MSESELENOMETHIONINE | P - 85 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 86 | 0 | 1 |
| MSESELENOMETHIONINE | E - 87 | 0 | 1 |
| GOLGLYCEROL | R - 112 | 1 | 0 |
| MSESELENOMETHIONINE | R - 112 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|