|
|
|
|
|
|
|
| Information on 1dv8_A_221 |
|
Loop code: 1dv8_A_221 PDB: 1dv8 Chain: A Type: AR beta-beta link |
Loop Start: 221 Loop Length: 31 Sec Struct Nt length: 2 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | KWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHF |
| Sec Struct: | EETT---STTS---B-TT------TTSSSS---EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | Q - 239 | 0 | 1 |
| CACALCIUM ION | P - 240 | 0 | 1 |
| CACALCIUM ION | D - 241 | 0 | 1 |
| CACALCIUM ION | D - 242 | 0 | 1 |
| CACALCIUM ION | W - 243 | 0 | 1 |
| CACALCIUM ION | G - 251 | 0 | 1 |
| CACALCIUM ION | E - 252 | 0 | 1 |
| CACALCIUM ION | D - 253 | 0 | 1 |
| CACALCIUM ION | C - 254 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|