|
|
|
|
|
|
|
| Information on 1g9m_G_199 |
|
Loop code: 1g9m_G_199 PDB: 1g9m Chain: G Type: AR beta-beta link |
Loop Start: 199 Loop Length: 21 Sec Struct Nt length: 3 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | SVITQACPKVSFEPIPIHYCAPAGFAILKC |
| Sec Struct: | EEE-------------B--B--TTEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| NAGN-ACETYL-D-GLUCOSAMINE | P - 212 | 0 | 1 |
| NAGN-ACETYL-D-GLUCOSAMINE | C - 228 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|