|
|
|
|
|
|
|
| Information on 1ug9_A_562 |
|
Loop code: 1ug9_A_562 PDB: 1ug9 Chain: A Type: EH beta-alpha |
Loop Start: 562 Loop Length: 27 Sec Struct Nt length: 4 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | GRMWHRYTYDGYGEKADGSPWDGTGIGRLWPLLSGERGEYALA |
| Sec Struct: | EEEE-SBTT---S--TTS---SS-----B-THHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | W - 565 | 0 | 1 |
| GOLGLYCEROL | H - 566 | 0 | 1 |
| GOLGLYCEROL | R - 567 | 0 | 1 |
| GOLGLYCEROL | L - 593 | 0 | 1 |
| GOLGLYCEROL | L - 594 | 1 | 0 |
| GOLGLYCEROL | S - 595 | 1 | 0 |
| GOLGLYCEROL | E - 597 | 1 | 0 |
| GOLGLYCEROL | R - 598 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|