|
|
|
|
|
|
|
| Information on 1uuq_A_280 |
|
Loop code: 1uuq_A_280 PDB: 1uuq Chain: A Type: EH beta-alpha |
Loop Start: 280 Loop Length: 12 Sec Struct Nt length: 5 Sec Struct Ct length: 26 Structure geometry
|
| Sequence: | LTYHMWIRNWSWFDKTKPAETWPSAWEKAQNYMRAHIDVAKQL |
| Sec Struct: | EEEEE-TTTTTSS-TTSHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | W - 285 | 0 | 1 |
| GOLGLYCEROL | R - 287 | 0 | 1 |
| GOLGLYCEROL | N - 288 | 0 | 1 |
| GOLGLYCEROL | W - 289 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC3 - GOL BINDING SITE FOR CHAIN A | W - 285 | 0 | 1 |
| AC3 - GOL BINDING SITE FOR CHAIN A | N - 288 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|