|
|
|
|
|
|
|
| Information on 1k4k_A_35 |
|
Loop code: 1k4k_A_35 PDB: 1k4k Chain: A Type: EH beta-alpha |
Loop Start: 35 Loop Length: 13 Sec Struct Nt length: 5 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | VTIIPNNVPPHRPQPEANSVQRKHMLELAI |
| Sec Struct: | EEEEE----TTS---SS-HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| XEXENON | I - 37 | 1 | 0 |
| XEXENON | I - 38 | 0 | 1 |
| XEXENON | L - 60 | 1 | 0 |
| XEXENON | A - 63 | 1 | 0 |
| XEXENON | I - 64 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|