|
|
|
|
|
|
|
| Information on 1ltq_A_160 |
|
Loop code: 1ltq_A_160 PDB: 1ltq Chain: A Type: EH beta-alpha |
Loop Start: 160 Loop Length: 26 Sec Struct Nt length: 6 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | KAVIFDVDGTLAKNGRGPYDLEKCDTDVINPVVELS |
| Sec Struct: | EEEEEETBTTTB-----TT-GGGGGG--B---HHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | D - 167 | 0 | 1 |
| MSESELENOMETHIONINE | A - 171 | 0 | 1 |
| MSESELENOMETHIONINE | K - 172 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|