|
|
|
|
|
|
|
| Information on 1o9p_A_338 |
|
Loop code: 1o9p_A_338 PDB: 1o9p Chain: A Type: EH beta-alpha |
Loop Start: 338 Loop Length: 20 Sec Struct Nt length: 5 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | VLLTYSAPGTAPAKALASTGDPRYNRLWTLM |
| Sec Struct: | EEEEESSSSS--BGGG-----GGGTHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MLAMALONIC ACID | T - 356 | 0 | 1 |
| MLAMALONIC ACID | G - 357 | 0 | 1 |
| MLAMALONIC ACID | P - 359 | 0 | 1 |
| MLAMALONIC ACID | N - 362 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC1 - MLA BINDING SITE FOR CHAIN A | P - 359 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|