|
|
|
|
|
|
|
| Information on 1g01_A_437 |
|
Loop code: 1g01_A_437 PDB: 1g01 Chain: A Type: EH beta-alpha |
Loop Start: 437 Loop Length: 22 Sec Struct Nt length: 8 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | IMYSVHFYTGSHGASHIGYPEGTPSSERSNVMANVRYALD |
| Sec Struct: | EEEEEEEETTTS--------TT--GGG---HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CDCADMIUM ION | H - 442 | 1 | 0 |
| CDCADMIUM ION | Y - 444 | 0 | 1 |
| CDCADMIUM ION | T - 459 | 0 | 1 |
| CDCADMIUM ION | P - 460 | 0 | 1 |
| CDCADMIUM ION | E - 463 | 0 | 1 |
| CDCADMIUM ION | R - 472 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|