|
|
|
|
|
|
|
| Information on 1ouo_A_76 |
|
Loop code: 1ouo_A_76 PDB: 1ouo Chain: A Type: EH beta-alpha |
Loop Start: 76 Loop Length: 11 Sec Struct Nt length: 5 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | IEWEHVVPAWQFGHHRQCWQKGGRKNCSKN |
| Sec Struct: | EEEEESS-TTTTTTTSHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | W - 78 | 1 | 0 |
| MGMAGNESIUM ION | E - 79 | 0 | 1 |
| MGMAGNESIUM ION | H - 80 | 0 | 1 |
| MSESELENOMETHIONINE | H - 80 | 0 | 1 |
| MSESELENOMETHIONINE | V - 82 | 0 | 1 |
| MGMAGNESIUM ION | P - 83 | 0 | 1 |
| MSESELENOMETHIONINE | F - 87 | 0 | 1 |
| MSESELENOMETHIONINE | G - 88 | 0 | 1 |
| MSESELENOMETHIONINE | R - 91 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|