|
|
|
|
|
|
|
| Information on 1f1z_A_13 |
|
Loop code: 1f1z_A_13 PDB: 1f1z Chain: A Type: HE alpha-beta |
Loop Start: 13 Loop Length: 26 Sec Struct Nt length: 6 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | IARRIKEGRGQGHGKDYIPWLTVQEVPSSGRSHRIY |
| Sec Struct: | HHHHHHTTTT---GGG---SS-GGG--SS---EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | L - 33 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|