|
|
|
|
|
|
|
| Information on 1slm_*_64 |
|
Loop code: 1slm_*_64 PDB: 1slm Chain: * Type: HE alpha-beta |
Loop Start: 64 Loop Length: 26 Sec Struct Nt length: 6 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | SDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRI |
| Sec Struct: | HHHHHHTTS-B-SS-SSS--SS----SS-S-SEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | C - 75 | 0 | 1 |
| ZNZINC ION | G - 76 | 0 | 1 |
| ZNZINC ION | V - 77 | 0 | 1 |
| CACALCIUM ION | W - 92 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| ZN1 - ZN1 ARE THE LIGANDS OF THE CATALYTIC (ZN 257) ZINC ION. | C - 75 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|