|
|
|
|
|
|
|
| Information on 1ntv_A_58 |
|
Loop code: 1ntv_A_58 PDB: 1ntv Chain: A Type: HE alpha-beta |
Loop Start: 58 Loop Length: 6 Sec Struct Nt length: 19 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | DKLCQDSMMKLKGVVAGARSKGEHKQKIFLTIS |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHTTT---EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | V - 72 | 1 | 0 |
| PO4PHOSPHATE ION | R - 76 | 0 | 1 |
| PO4PHOSPHATE ION | E - 80 | 0 | 1 |
| PO4PHOSPHATE ION | H - 81 | 0 | 1 |
| PO4PHOSPHATE ION | K - 82 | 0 | 1 |
| PO4PHOSPHATE ION | Q - 83 | 0 | 1 |
| PO4PHOSPHATE ION | K - 84 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|