|
|
|
|
|
|
|
| Information on 1req_A_284 |
|
Loop code: 1req_A_284 PDB: 1req Chain: A Type: EH beta-alpha |
Loop Start: 284 Loop Length: 3 Sec Struct Nt length: 7 Sec Struct Ct length: 20 Structure geometry
|
| Sequence: | LSFFWGIGMNFFMEVAKLRAARMLWAKLVH |
| Sec Struct: | EEEEEEE-S-HHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| DCADESULFO-COENZYME A | S - 285 | 1 | 0 |
| DCADESULFO-COENZYME A | F - 286 | 1 | 0 |
| DCADESULFO-COENZYME A | F - 287 | 1 | 0 |
| GOLGLYCEROL | F - 287 | 1 | 0 |
| GOLGLYCEROL | G - 291 | 0 | 1 |
| GOLGLYCEROL | M - 292 | 0 | 1 |
| GOLGLYCEROL | N - 293 | 0 | 1 |
| GOLGLYCEROL | M - 296 | 1 | 0 |
| GOLGLYCEROL | E - 297 | 1 | 0 |
| Associated ArchDB-EC Subclass to 1req_A_284 |
| For any comment or web-related incidence, send an email to the webmaster. |
|